PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 300aa    MW: 34791 Da    PI: 6.672
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591047.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.2e-5371351128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eelv +yLk+k+++ k++l +vi+++d+y++ePwd++      ++e+kewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+v
  XP_009591047.1   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVITDIDLYRMEPWDIQDrckLGYEEQKEWYFFSHKDRKYPTGTRTNRATATGFWKATGRDKAV 100
                     69****************************.9***************952432334677************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ls k++ +g++ktLvfy+grap+g+k+dW+mheyrl
  XP_009591047.1 101 LS-KEKIIGMRKTLVFYTGRAPNGRKSDWIMHEYRL 135
                     **.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-594156IPR003441NAC domain
PROSITE profilePS5100557.9647156IPR003441NAC domain
PfamPF023651.2E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MEMESCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIT DIDLYRMEPW DIQDRCKLGY  60
EEQKEWYFFS HKDRKYPTGT RTNRATATGF WKATGRDKAV LSKEKIIGMR KTLVFYTGRA  120
PNGRKSDWIM HEYRLQTSQH GPPQEEGWVV CRAFKKPTPS NNPSLESWKN ASAYNCIKGT  180
NTSYRPPSEM PSPMHYNPFN QTSNLNHQFP FNPSPHHHQD LISSQILGFE NQLVELPQLD  240
SPTISTSLAT HEEEKNSYGS NCQFFDMIEA PSSSYSFPNL PLVDDDQNRM SQLLQCYPDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-49215610168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869360.0JQ686936.1 Nicotiana tabacum cultivar SR1 NAC domain-containing protein 7 (VND7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591047.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9C8W91e-110NAC30_ARATH; NAC domain-containing protein 30
TrEMBLV9LXL00.0V9LXL0_TOBAC; NAC domain-containing protein 7
STRINGPGSC0003DMT4000023181e-151(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-101vascular related NAC-domain protein 7